SCOPe 2.05: Domain d1qnub_: 1qnu B:

Lineage for d1qnub_ (1qnu B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
   identical sequence with verotoxin-1 B

8. Domain d1qnub_: 1qnu B: [25102]
   complexed with emb, mec

Details for d1qnub_

PDB Entry: 1qnu, 2.23 Å

PDB Description: shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor

PDB Compounds: (B:) shiga-like toxin I b subunit

SCOPe Domain Sequences for d1qnub_:

Sequence; same for both SEQRES and ATOM records:

>d1qnub_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d1qnub_:

• d1qnub_ first appeared (with stable ids) in SCOP 1.55
  
• d1qnub_ appears in SCOPe 2.04
  
• d1qnub_ appears in SCOPe 2.06
  
• d1qnub_ appears in the current release, SCOPe 2.08