Lineage for d1qnub_ (1qnu B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 374244Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 374337Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
    identical sequence with verotoxin-1 B
  8. 374339Domain d1qnub_: 1qnu B: [25102]

Details for d1qnub_

PDB Entry: 1qnu (more details), 2.23 Å

PDB Description: shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor

SCOP Domain Sequences for d1qnub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnub_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1qnub_:

Click to download the PDB-style file with coordinates for d1qnub_.
(The format of our PDB-style files is described here.)

Timeline for d1qnub_: