Lineage for d4aeya_ (4aey A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966888Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2966889Protein automated matches [227009] (16 species)
    not a true protein
  7. 2967000Species Pseudomonas aeruginosa [TaxId:287] [230992] (2 PDB entries)
  8. 2967007Domain d4aeya_: 4aey A: [251019]
    automated match to d1b9la_

Details for d4aeya_

PDB Entry: 4aey (more details), 3 Å

PDB Description: Crystal structure of FolX from Pseudomonas aeruginosa
PDB Compounds: (A:) d-erythro-7,8-dihydroneopterin triphosphate epimerase

SCOPe Domain Sequences for d4aeya_:

Sequence, based on SEQRES records: (download)

>d4aeya_ d.96.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
pgmarirvkdlrlrtfigikeeeilnkqdvlinltilypaadavevndiehalnyrtitk
aiirhveenrfallermtqeildlvmenpavryaevevdkphalrfaesvsitlagh

Sequence, based on observed residues (ATOM records): (download)

>d4aeya_ d.96.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
pgmarirvkdlrlrtfigikeeeilnkqdvlinltilypahalnyrtitkaiirhveenr
fallermtqeildlvmenpavryaevevdkphalrfaesvsitlagh

SCOPe Domain Coordinates for d4aeya_:

Click to download the PDB-style file with coordinates for d4aeya_.
(The format of our PDB-style files is described here.)

Timeline for d4aeya_: