Lineage for d4ae1b3 (4ae1 B:381-535)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767183Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) (S)
    automatically mapped to Pfam PF01324
  5. 2767198Family b.2.1.0: automated matches [254321] (1 protein)
    not a true family
  6. 2767199Protein automated matches [254735] (1 species)
    not a true protein
  7. 2767200Species Corynebacterium diphtheriae [TaxId:1717] [256178] (7 PDB entries)
  8. 2767203Domain d4ae1b3: 4ae1 B:381-535 [251016]
    Other proteins in same PDB: d4ae1a1, d4ae1a2, d4ae1b1, d4ae1b2
    automated match to d1f0la1
    complexed with nca; mutant

Details for d4ae1b3

PDB Entry: 4ae1 (more details), 2.08 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197 in complex with nicotinamide
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d4ae1b3:

Sequence, based on SEQRES records: (download)

>d4ae1b3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Sequence, based on observed residues (ATOM records): (download)

>d4ae1b3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktkvnsklslffeiks

SCOPe Domain Coordinates for d4ae1b3:

Click to download the PDB-style file with coordinates for d4ae1b3.
(The format of our PDB-style files is described here.)

Timeline for d4ae1b3: