SCOPe 2.06: Domain d4ae1b2: 4ae1 B:201-380

Lineage for d4ae1b2 (4ae1 B:201-380)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.0: automated matches [254320] (1 protein)
   not a true family

6. Protein automated matches [254734] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256177] (3 PDB entries)

8. Domain d4ae1b2: 4ae1 B:201-380 [251015]
   Other proteins in same PDB: d4ae1a1, d4ae1a3, d4ae1b1, d4ae1b3
   automated match to d1ddta3
   complexed with nca; mutant

Details for d4ae1b2

PDB Entry: 4ae1, 2.08 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197 in complex with nicotinamide

PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d4ae1b2:

Sequence, based on SEQRES records:

>d4ae1b2 f.1.2.0 (B:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpay

Sequence, based on observed residues (ATOM records):

>d4ae1b2 f.1.2.0 (B:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgelvgfaaynfvesiinlfqvvhnsynrpay

Timeline for d4ae1b2:

• d4ae1b2 first appeared in SCOPe 2.04
  
• d4ae1b2 appears in SCOPe 2.05
  
• d4ae1b2 appears in SCOPe 2.07
  
• d4ae1b2 appears in the current release, SCOPe 2.08