Lineage for d4ae1b2 (4ae1 B:201-380)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250866Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 2250881Family f.1.2.0: automated matches [254320] (1 protein)
    not a true family
  6. 2250882Protein automated matches [254734] (1 species)
    not a true protein
  7. 2250883Species Corynebacterium diphtheriae [TaxId:1717] [256177] (3 PDB entries)
  8. 2250886Domain d4ae1b2: 4ae1 B:201-380 [251015]
    Other proteins in same PDB: d4ae1a1, d4ae1a3, d4ae1b1, d4ae1b3
    automated match to d1ddta3
    complexed with nca; mutant

Details for d4ae1b2

PDB Entry: 4ae1 (more details), 2.08 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197 in complex with nicotinamide
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d4ae1b2:

Sequence, based on SEQRES records: (download)

>d4ae1b2 f.1.2.0 (B:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpay

Sequence, based on observed residues (ATOM records): (download)

>d4ae1b2 f.1.2.0 (B:201-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgelvgfaaynfvesiinlfqvvhnsynrpay

SCOPe Domain Coordinates for d4ae1b2:

Click to download the PDB-style file with coordinates for d4ae1b2.
(The format of our PDB-style files is described here.)

Timeline for d4ae1b2: