SCOPe 2.05: Domain d4ae1b1: 4ae1 B:3-187

Lineage for d4ae1b1 (4ae1 B:3-187)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (7 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256176] (2 PDB entries)

8. Domain d4ae1b1: 4ae1 B:3-187 [251014]
   Other proteins in same PDB: d4ae1a2, d4ae1a3, d4ae1b2, d4ae1b3
   automated match to d1f0la2
   complexed with nca; mutant

Details for d4ae1b1

PDB Entry: 4ae1, 2.08 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197 in complex with nicotinamide

PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d4ae1b1:

Sequence, based on SEQRES records:

>d4ae1b1 d.166.1.0 (B:3-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
ddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkefystdnkyda
agysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgtee
fikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeym
aqaca

Sequence, based on observed residues (ATOM records):

>d4ae1b1 d.166.1.0 (B:3-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
ddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkkefystdnkydaagysvdnenplsg
kaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikrfgdgasrvv
lslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqaca

Timeline for d4ae1b1:

• d4ae1b1 first appeared in SCOPe 2.04
  
• d4ae1b1 appears in SCOPe 2.06
  
• d4ae1b1 appears in the current release, SCOPe 2.08