SCOPe 2.06: Domain d4ae1a1: 4ae1 A:1-187

Lineage for d4ae1a1 (4ae1 A:1-187)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256176] (3 PDB entries)

8. Domain d4ae1a1: 4ae1 A:1-187 [251011]
   Other proteins in same PDB: d4ae1a2, d4ae1a3, d4ae1b2, d4ae1b3
   automated match to d1f0la2
   complexed with nca; mutant

Details for d4ae1a1

PDB Entry: 4ae1, 2.08 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197 in complex with nicotinamide

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d4ae1a1:

Sequence, based on SEQRES records:

>d4ae1a1 d.166.1.0 (A:1-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkefystdnky
daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
ymaqaca

Sequence, based on observed residues (ATOM records):

>d4ae1a1 d.166.1.0 (A:1-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkkefystdnkydaagysvdnenpl
sgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikrfgdgasr
vvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqaca

Timeline for d4ae1a1:

• d4ae1a1 first appeared in SCOPe 2.04
  
• d4ae1a1 appears in SCOPe 2.05
  
• d4ae1a1 appears in SCOPe 2.07
  
• d4ae1a1 appears in the current release, SCOPe 2.08