SCOPe 2.06: Domain d4ae0a3: 4ae0 A:381-535

Lineage for d4ae0a3 (4ae0 A:381-535)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families)
   automatically mapped to Pfam PF01324

5. Family b.2.1.0: automated matches [254321] (1 protein)
   not a true family

6. Protein automated matches [254735] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256178] (3 PDB entries)

8. Domain d4ae0a3: 4ae0 A:381-535 [251010]
   Other proteins in same PDB: d4ae0a1, d4ae0a2
   automated match to d1f0la1
   mutant

Details for d4ae0a3

PDB Entry: 4ae0, 2 Å

PDB Description: Crystal structure of diphtheria toxin mutant CRM197

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d4ae0a3:

Sequence, based on SEQRES records:

>d4ae0a3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Sequence, based on observed residues (ATOM records):

>d4ae0a3 b.2.1.0 (A:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqkhtkvnsklslffeiks

Timeline for d4ae0a3:

• d4ae0a3 first appeared in SCOPe 2.04
  
• d4ae0a3 appears in SCOPe 2.05
  
• d4ae0a3 appears in SCOPe 2.07
  
• d4ae0a3 appears in the current release, SCOPe 2.08