Lineage for d4adtb_ (4adt B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079916Species Plasmodium berghei [TaxId:5821] [256175] (2 PDB entries)
  8. 2079918Domain d4adtb_: 4adt B: [251005]
    automated match to d2nv2i_
    complexed with po4

Details for d4adtb_

PDB Entry: 4adt (more details), 2.42 Å

PDB Description: Crystal structure of plasmodial PLP synthase
PDB Compounds: (B:) pyridoxine biosynthetic enzyme pdx1 homologue, putative

SCOPe Domain Sequences for d4adtb_:

Sequence, based on SEQRES records: (download)

>d4adtb_ c.1.2.0 (B:) automated matches {Plasmodium berghei [TaxId: 5821]}
cemlkggvimdvknveqakiaekagaigvmilenipselrntdgvarsvdplkieeirkc
isinvlakvrighfveaqileelkvdmldesevltmadeynhinkhkfktpfvcgctnlg
ealrrisegasmirtkgeagtgniieaikhirtvnneikylcsldesevynfakklrapi
dlilltrklkrlpvvnfaaggiatpadaamcmqlgmdgvfvgsgifesenpqkmassivm
avsnfnnpkillnvslglgkamhgntk

Sequence, based on observed residues (ATOM records): (download)

>d4adtb_ c.1.2.0 (B:) automated matches {Plasmodium berghei [TaxId: 5821]}
cemlkggvimdvknveqakiaekagaigvmileniptdgvarsvdplkieeirkcisinv
lakvrighfveaqileelkvdmldesevltmadeynhinkhkfktpfvcgctnlgealrr
isegasmirtkgeagtgniieaikhirtvnneikylcsldesevynfakklrapidlill
trklkrlpvvnfaaggiatpadaamcmqlgmdgvfvgsgifesenpqkmassivmavsnf
nnpkillnvslglgkamhgntk

SCOPe Domain Coordinates for d4adtb_:

Click to download the PDB-style file with coordinates for d4adtb_.
(The format of our PDB-style files is described here.)

Timeline for d4adtb_: