Lineage for d4adma_ (4adm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010473Species Mycobacterium tuberculosis [TaxId:83332] [225923] (5 PDB entries)
  8. 2010474Domain d4adma_: 4adm A: [251000]
    automated match to d4apbd_
    complexed with gol, srt

Details for d4adma_

PDB Entry: 4adm (more details), 1.65 Å

PDB Description: Crystal structure of Rv1098c in complex with meso-tartrate
PDB Compounds: (A:) fumarate hydratase class II

SCOPe Domain Sequences for d4adma_:

Sequence, based on SEQRES records: (download)

>d4adma_ a.127.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
nyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvnsdl
gllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvtlh
pnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrthl
mdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvvav
lvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltglae
iqlpdlqpgssimpgkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarn
ilesfklltnvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqa
lkerktirqtvidrgligdrlsiedldrrldvlamakae

Sequence, based on observed residues (ATOM records): (download)

>d4adma_ a.127.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
nyriehdtmgevrvpakalwraqtqravenfpisgrglertqiralgllkgacaqvnsdl
gllapekadaiiaaaaeiadgqhddqfpidvfqtgsgtssnmntneviasiaakggvtlh
pnddvnmsqssndtfptathiaateaavahlipalqqlhdalaakaldwhtvvksgrthl
mdavpvtlgqefsgyarqieagiervraclprlgelaiggtavgtglnapddfgvrvvav
lvaqtglselrtaansfeaqaardglveasgalrtiavsltkiandirwmgsgpltglae
iqlpdlkvnpvlpeavtqvaaqvigndaaiawggangafelnvyipmmarnilesfkllt
nvsrlfaqrciagltanvehlrrlaesspsivtplnsaigyeeaaavakqalkerktirq
tvidrgligdrlsiedldrrldvlamakae

SCOPe Domain Coordinates for d4adma_:

Click to download the PDB-style file with coordinates for d4adma_.
(The format of our PDB-style files is described here.)

Timeline for d4adma_: