Lineage for d4adeb_ (4ade B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132486Species Escherichia coli [TaxId:511693] [234051] (4 PDB entries)
  8. 2132500Domain d4adeb_: 4ade B: [250995]
    automated match to d4adba_

Details for d4adeb_

PDB Entry: 4ade (more details), 2.75 Å

PDB Description: Structural and functional study of succinyl-ornithine transaminase from E. coli
PDB Compounds: (B:) succinylornithine transaminase

SCOPe Domain Sequences for d4adeb_:

Sequence, based on SEQRES records: (download)

>d4adeb_ c.67.1.0 (B:) automated matches {Escherichia coli [TaxId: 511693]}
apfipvrgegsrlwdqqgkeyidfaggiavnalghahpelrealneqaskfwhtgngytn
epvlrlakklidatfadrvffcnsgaeaneaalklarkfahdrygshksgivafknafhg
rtlftvsaggqpaysqdfaplpadirhaayndinsasaliddstcavivepiqgeggvvp
asnaflqglrelcnrhnallifdevqtgvgrtgelyaymhygvtpdllttakalgggfpv
gallateecarvmtvgthgttyggnplasavagkvlelintpemlngvkqrhdwfverln
tinhryglfsevrglglligcvlnadyagqakqisqeaakagvmvliaggnvvrfapaln
vseeevttgldrfaaacehfvs

Sequence, based on observed residues (ATOM records): (download)

>d4adeb_ c.67.1.0 (B:) automated matches {Escherichia coli [TaxId: 511693]}
apfipvrgegsrlwdqqgkeyidfaggiavnalghahpelrealneqaskfwhtgngytn
epvlrlakklidatfadrvffcnsgaeaneaalklarkfahdrygshksgivafknafhg
rdirhaayndinsasaliddstcavivepiqgeggvvpasnaflqglrelcnrhnallif
devqtgvgrtgelyaymhygvtpdllttakalgggfpvgallateecarvmgnplasava
gkvlelintpemlngvkqrhdwfverlntinhryglfsevrglglligcvlnadyagqak
qisqeaakagvmvliaggnvvrfapalnvseeevttgldrfaaacehfvs

SCOPe Domain Coordinates for d4adeb_:

Click to download the PDB-style file with coordinates for d4adeb_.
(The format of our PDB-style files is described here.)

Timeline for d4adeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4adea_