Lineage for d1czge_ (1czg E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667367Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 667664Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 667665Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 667735Domain d1czge_: 1czg E: [25099]
    mutant

Details for d1czge_

PDB Entry: 1czg (more details), 2.5 Å

PDB Description: structure of the g62t mutant of shiga-like toxin i b subunit
PDB Compounds: (E:) shiga toxin b-chain

SCOP Domain Sequences for d1czge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czge_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

SCOP Domain Coordinates for d1czge_:

Click to download the PDB-style file with coordinates for d1czge_.
(The format of our PDB-style files is described here.)

Timeline for d1czge_: