SCOPe 2.04: Domain d4acga_: 4acg A:

Lineage for d4acga_ (4acg A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)

8. Domain d4acga_: 4acg A: [250986]
   automated match to d1j1bb_
   complexed with 6lq

Details for d4acga_

PDB Entry: 4acg, 2.6 Å

PDB Description: gsk3b in complex with inhibitor

PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d4acga_:

Sequence; same for both SEQRES and ATOM records:

>d4acga_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq

Timeline for d4acga_:

• d4acga_ is new in SCOPe 2.04-stable
  
• d4acga_ appears in SCOPe 2.05
  
• d4acga_ appears in the current release, SCOPe 2.08