Lineage for d4aayd_ (4aay D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782564Species Arsenite-oxidising bacterium [TaxId:97708] [256174] (1 PDB entry)
  8. 2782566Domain d4aayd_: 4aay D: [250979]
    automated match to d1g8kb_
    complexed with 4mo, f3s, fes, mgd, o

Details for d4aayd_

PDB Entry: 4aay (more details), 2.7 Å

PDB Description: Crystal Structure of the arsenite oxidase protein complex from Rhizobium species strain NT-26
PDB Compounds: (D:) arob

SCOPe Domain Sequences for d4aayd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aayd_ b.33.1.0 (D:) automated matches {Arsenite-oxidising bacterium [TaxId: 97708]}
aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
phkgfplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
deliygrlsnvl

SCOPe Domain Coordinates for d4aayd_:

Click to download the PDB-style file with coordinates for d4aayd_.
(The format of our PDB-style files is described here.)

Timeline for d4aayd_: