Lineage for d1czgc_ (1czg C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398212Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2398219Species Escherichia coli [TaxId:562] [50211] (15 PDB entries)
  8. 2398307Domain d1czgc_: 1czg C: [25097]
    mutant

Details for d1czgc_

PDB Entry: 1czg (more details), 2.5 Å

PDB Description: structure of the g62t mutant of shiga-like toxin i b subunit
PDB Compounds: (C:) shiga toxin b-chain

SCOPe Domain Sequences for d1czgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czgc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

SCOPe Domain Coordinates for d1czgc_:

Click to download the PDB-style file with coordinates for d1czgc_.
(The format of our PDB-style files is described here.)

Timeline for d1czgc_: