SCOPe 2.05: Domain d1czgc_: 1czg C:

Lineage for d1czgc_ (1czg C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (14 PDB entries)

8. Domain d1czgc_: 1czg C: [25097]
   mutant

Details for d1czgc_

PDB Entry: 1czg, 2.5 Å

PDB Description: structure of the g62t mutant of shiga-like toxin i b subunit

PDB Compounds: (C:) shiga toxin b-chain

SCOPe Domain Sequences for d1czgc_:

Sequence; same for both SEQRES and ATOM records:

>d1czgc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

Timeline for d1czgc_:

• d1czgc_ first appeared (with stable ids) in SCOP 1.55
  
• d1czgc_ appears in SCOPe 2.04
  
• d1czgc_ appears in SCOPe 2.06
  
• d1czgc_ appears in the current release, SCOPe 2.08