Lineage for d1czgc_ (1czg C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13820Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 13821Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 13909Domain d1czgc_: 1czg C: [25097]

Details for d1czgc_

PDB Entry: 1czg (more details), 2.5 Å

PDB Description: structure of the g62t mutant of shiga-like toxin i b subunit

SCOP Domain Sequences for d1czgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czgc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

SCOP Domain Coordinates for d1czgc_:

Click to download the PDB-style file with coordinates for d1czgc_.
(The format of our PDB-style files is described here.)

Timeline for d1czgc_: