Lineage for d4a76a_ (4a76 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789742Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1789743Protein automated matches [190576] (23 species)
    not a true protein
  7. 1789882Species Xenopus (Silurana) tropicalis [TaxId:8364] [256121] (3 PDB entries)
  8. 1789889Domain d4a76a_: 4a76 A: [250967]
    automated match to d4a4ib_
    protein/DNA complex

Details for d4a76a_

PDB Entry: 4a76 (more details), 1.92 Å

PDB Description: the lin28b cold shock domain in complex with heptathymidine
PDB Compounds: (A:) lin28 cold shock domain

SCOPe Domain Sequences for d4a76a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a76a_ b.40.4.0 (A:) automated matches {Xenopus (Silurana) tropicalis [TaxId: 8364]}
pqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepve
ftfkksskgfeslrvtgpggnpclgn

SCOPe Domain Coordinates for d4a76a_:

Click to download the PDB-style file with coordinates for d4a76a_.
(The format of our PDB-style files is described here.)

Timeline for d4a76a_: