SCOPe 2.06: Domain d4a75g1: 4a75 G:27-113

Lineage for d4a75g1 (4a75 G:27-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (33 species)
   not a true protein

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [256121] (3 PDB entries)

8. Domain d4a75g1: 4a75 G:27-113 [250966]
   Other proteins in same PDB: d4a75a2, d4a75e2, d4a75g2
   automated match to d4a4ib_
   protein/DNA complex; protein/RNA complex; complexed with scn

Details for d4a75g1

PDB Entry: 4a75, 1.75 Å

PDB Description: the lin28b cold shock domain in complex with hexathymidine.

PDB Compounds: (G:) lin28 cold shock domain

SCOPe Domain Sequences for d4a75g1:

Sequence; same for both SEQRES and ATOM records:

>d4a75g1 b.40.4.0 (G:27-113) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepv
eftfkksskgfeslrvtgpggnpclgn

Timeline for d4a75g1:

• d4a75g1 first appeared in SCOPe 2.04, called d4a75g_
  
• d4a75g1 was called d4a75g_ in SCOPe 2.05
  
• d4a75g1 appears in SCOPe 2.07
  
• d4a75g1 appears in the current release, SCOPe 2.08