Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (33 species) not a true protein |
Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [256121] (3 PDB entries) |
Domain d4a75c_: 4a75 C: [250964] Other proteins in same PDB: d4a75a2, d4a75e2, d4a75g2 automated match to d4a4ib_ protein/DNA complex; protein/RNA complex; complexed with scn |
PDB Entry: 4a75 (more details), 1.75 Å
SCOPe Domain Sequences for d4a75c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a75c_ b.40.4.0 (C:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} dpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepv eftfkksskgfeslrvtgpggnpclgn
Timeline for d4a75c_: