SCOPe 2.05: Domain d4a73d2: 4a73 D:165-331

Lineage for d4a73d2 (4a73 D:165-331)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries)

8. Domain d4a73d2: 4a73 D:165-331 [250962]
   Other proteins in same PDB: d4a73a1, d4a73b1, d4a73c1, d4a73d1
   automated match to d2v7pa2
   mutant

Details for d4a73d2

PDB Entry: 4a73, 3 Å

PDB Description: single point mutant of thermus thermophilus lactate dehydrogenase

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4a73d2:

Sequence; same for both SEQRES and ATOM records:

>d4a73d2 d.162.1.0 (D:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargaal
spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg
vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf

Timeline for d4a73d2:

• d4a73d2 first appeared in SCOPe 2.04
  
• d4a73d2 appears in SCOPe 2.06
  
• d4a73d2 appears in the current release, SCOPe 2.08