Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries) |
Domain d4a73b2: 4a73 B:165-331 [250958] Other proteins in same PDB: d4a73a1, d4a73b1, d4a73c1, d4a73d1 automated match to d2v7pa2 mutant |
PDB Entry: 4a73 (more details), 3 Å
SCOPe Domain Sequences for d4a73b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a73b2 d.162.1.0 (B:165-331) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargaal spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpeveg vlevslslprilgaggvegtvypslspeerealrrsaeilkeaafalgf
Timeline for d4a73b2: