Lineage for d4a6rb_ (4a6r B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132397Species Chromobacterium violaceum [TaxId:536] [234042] (7 PDB entries)
  8. 2132399Domain d4a6rb_: 4a6r B: [250948]
    automated match to d4a6tb_
    complexed with ta8

Details for d4a6rb_

PDB Entry: 4a6r (more details), 1.35 Å

PDB Description: Crystal structure of the omega transaminase from Chromobacterium violaceum in the apo form, crystallised from polyacrylic acid
PDB Compounds: (B:) omega transaminase

SCOPe Domain Sequences for d4a6rb_:

Sequence, based on SEQRES records: (download)

>d4a6rb_ c.67.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 536]}
rvmtrgegvylwdsegnkiidgmaglwcvnvgygrkdfaeaarrqmeelpfyntffktth
pavvelssllaevtpagfdrvfytnsgsesvdtmirmvrrywdvqgkpekktligrwngy
hgstiggaslggmkymheqgdlpipgmahieqpwwykhgkdmtpdefgvvaarwleekil
eigadkvaafvgepiqgaggvivppatywpeiericrkydvllvadevicgfgrtgewfg
hqhfgfqpdlftaakglssgylpigavfvgkrvaegliaggdfnhgftysghpvcaavah
anvaalrdegivqrvkddigpymqkrwretfsrfehvddvrgvgmvqaftlvknkakrel
fpdfgeigtlcrdiffrnnlimracgdhivsapplvmtraevdemlavaercleefeqtl
kargla

Sequence, based on observed residues (ATOM records): (download)

>d4a6rb_ c.67.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 536]}
rvmtrgegvylwdsegnkiidgmaglwcvnvgygrkdfaeaarrqmeelpfyntffktth
pavvelssllaevtpagfdrvfytnsgsesvdtmirmvrrywdvqgkpekktligrwngy
hgstiggaslggmkymhlpipgmahieqpwwykhgkdmtpdefgvvaarwleekileiga
dkvaafvgepiqgaggvivppatywpeiericrkydvllvadevicgfgrtgewfghqhf
gfqpdlftaakglssgylpigavfvgkrvaegliaggdfnhgftysghpvcaavahanva
alrdegivqrvkddigpymqkrwretfsrfehvddvrgvgmvqaftlvknkakrelfpdf
geigtlcrdiffrnnlimracgdhivsapplvmtraevdemlavaercleefeqtlkarg
la

SCOPe Domain Coordinates for d4a6rb_:

Click to download the PDB-style file with coordinates for d4a6rb_.
(The format of our PDB-style files is described here.)

Timeline for d4a6rb_: