Lineage for d4a69d_ (4a69 D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477818Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1477892Protein automated matches [254733] (1 species)
    not a true protein
  7. 1477893Species Human (Homo sapiens) [TaxId:9606] [256173] (1 PDB entry)
  8. 1477895Domain d4a69d_: 4a69 D: [250946]
    automated match to d1xc5a1
    complexed with act, gol, i0p, k, zn

Details for d4a69d_

PDB Entry: 4a69 (more details), 2.06 Å

PDB Description: Structure of HDAC3 bound to corepressor and inositol tetraphosphate
PDB Compounds: (D:) Nuclear receptor corepressor 2

SCOPe Domain Sequences for d4a69d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a69d_ a.4.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfinmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecv
lyyyltkk

SCOPe Domain Coordinates for d4a69d_:

Click to download the PDB-style file with coordinates for d4a69d_.
(The format of our PDB-style files is described here.)

Timeline for d4a69d_: