| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
| Protein automated matches [254733] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [256173] (1 PDB entry) |
| Domain d4a69c_: 4a69 C: [250945] automated match to d1xc5a1 complexed with act, gol, i0p, k, zn |
PDB Entry: 4a69 (more details), 2.06 Å
SCOPe Domain Sequences for d4a69c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a69c_ a.4.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfinmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecv
lyyyltkkn
Timeline for d4a69c_: