Lineage for d4a69c_ (4a69 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305482Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2305577Protein automated matches [254733] (1 species)
    not a true protein
  7. 2305578Species Human (Homo sapiens) [TaxId:9606] [256173] (1 PDB entry)
  8. 2305579Domain d4a69c_: 4a69 C: [250945]
    automated match to d1xc5a1
    complexed with act, gol, i0p, k, zn

Details for d4a69c_

PDB Entry: 4a69 (more details), 2.06 Å

PDB Description: Structure of HDAC3 bound to corepressor and inositol tetraphosphate
PDB Compounds: (C:) Nuclear receptor corepressor 2

SCOPe Domain Sequences for d4a69c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a69c_ a.4.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfinmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecv
lyyyltkkn

SCOPe Domain Coordinates for d4a69c_:

Click to download the PDB-style file with coordinates for d4a69c_.
(The format of our PDB-style files is described here.)

Timeline for d4a69c_: