SCOPe 2.08: Domain d4a69c_: 4a69 C:

Lineage for d4a69c_ (4a69 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein automated matches [254733] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256173] (1 PDB entry)

8. Domain d4a69c_: 4a69 C: [250945]
   automated match to d1xc5a1
   complexed with act, gol, i0p, k, zn

Details for d4a69c_

PDB Entry: 4a69, 2.06 Å

PDB Description: Structure of HDAC3 bound to corepressor and inositol tetraphosphate

PDB Compounds: (C:) Nuclear receptor corepressor 2

SCOPe Domain Sequences for d4a69c_:

Sequence; same for both SEQRES and ATOM records:

>d4a69c_ a.4.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfinmnglmadpmkvykdrqvmnmwseqeketfrekfmqhpknfgliasflerktvaecv
lyyyltkkn

Timeline for d4a69c_:

• d4a69c_ first appeared in SCOPe 2.04
  
• d4a69c_ appears in SCOPe 2.07