| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries) |
| Domain d4a68a3: 4a68 A:357-510 [250944] automated match to d1gska3 complexed with cu, epe, mpd, oh, per; mutant |
PDB Entry: 4a68 (more details), 2 Å
SCOPe Domain Sequences for d4a68a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a68a3 b.6.1.0 (A:357-510) automated matches {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditd
Timeline for d4a68a3: