SCOPe 2.04: Domain d4a68a1: 4a68 A:2-182

Lineage for d4a68a1 (4a68 A:2-182)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (20 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries)

8. Domain d4a68a1: 4a68 A:2-182 [250942]
   automated match to d1gska1
   complexed with cu, epe, mpd, oh, per; mutant

Details for d4a68a1

PDB Entry: 4a68, 2 Å

PDB Description: Mutations in the neighbourhood of CotA-laccase trinuclear site: D116N mutant

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d4a68a1:

Sequence, based on SEQRES records:

>d4a68a1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsngypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records):

>d4a68a1 b.6.1.0 (A:2-182) automated matches {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsngypeawfskdfe
qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

Timeline for d4a68a1:

• d4a68a1 is new in SCOPe 2.04-stable
  
• d4a68a1 appears in SCOPe 2.05
  
• d4a68a1 appears in the current release, SCOPe 2.08