Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [255666] (7 PDB entries) |
Domain d4a66a2: 4a66 A:183-356 [250937] automated match to d1gska2 complexed with cu, edo, per; mutant |
PDB Entry: 4a66 (more details), 1.95 Å
SCOPe Domain Sequences for d4a66a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a66a2 b.6.1.0 (A:183-356) automated matches {Bacillus subtilis [TaxId: 1423]} klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla
Timeline for d4a66a2: