| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries) |
| Domain d4a5me_: 4a5m E: [250932] automated match to d4a5nb_ complexed with cl, edo |
PDB Entry: 4a5m (more details), 3 Å
SCOPe Domain Sequences for d4a5me_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5me_ a.4.5.0 (E:) automated matches {Bacillus subtilis [TaxId: 1423]}
cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre
vyhqvppkveysltefgrtlepivlqmkewgesnrd
Timeline for d4a5me_: