Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187193] (9 PDB entries) |
Domain d4a5ma_: 4a5m A: [250928] automated match to d4a5nb_ complexed with cl, edo |
PDB Entry: 4a5m (more details), 3 Å
SCOPe Domain Sequences for d4a5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a5ma_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} cpveftldviggkwkgilfyhmidgkkrfnefrricpsitqrmltlqlreleadgivhre vyhqvppkveysltefgrtlepivlqmkewgesnrd
Timeline for d4a5ma_: