Lineage for d4a52a2 (4a52 A:52-167)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434172Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2434173Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
    automatically mapped to Pfam PF03734
  5. 2434174Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 2434185Protein automated matches [234004] (3 species)
    not a true protein
  7. 2434198Species Bacillus subtilis [TaxId:224308] [256166] (2 PDB entries)
  8. 2434200Domain d4a52a2: 4a52 A:52-167 [250927]
    Other proteins in same PDB: d4a52a1, d4a52a3, d4a52a4
    automated match to d1y7ma1
    complexed with im2

Details for d4a52a2

PDB Entry: 4a52 (more details)

PDB Description: nmr structure of the imipenem-acylated l,d-transpeptidase from bacillus subtilis
PDB Compounds: (A:) putative l, d-transpeptidase ykud

SCOPe Domain Sequences for d4a52a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a52a2 b.160.1.1 (A:52-167) automated matches {Bacillus subtilis [TaxId: 224308]}
pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf
gaywlslskqhygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr

SCOPe Domain Coordinates for d4a52a2:

Click to download the PDB-style file with coordinates for d4a52a2.
(The format of our PDB-style files is described here.)

Timeline for d4a52a2: