Lineage for d4a4ga_ (4a4g A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394117Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2394271Protein automated matches [190752] (1 species)
    not a true protein
  7. 2394272Species Human (Homo sapiens) [TaxId:9606] [187947] (9 PDB entries)
  8. 2394292Domain d4a4ga_: 4a4g A: [250922]
    automated match to d1mhna_
    protein/RNA complex; complexed with da2

Details for d4a4ga_

PDB Entry: 4a4g (more details)

PDB Description: Solution structure of SMN Tudor domain in complex with asymmetrically dimethylated arginine
PDB Compounds: (A:) Survival motor neuron protein

SCOPe Domain Sequences for d4a4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a4ga_ b.34.9.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntaaslqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdlls
pice

SCOPe Domain Coordinates for d4a4ga_:

Click to download the PDB-style file with coordinates for d4a4ga_.
(The format of our PDB-style files is described here.)

Timeline for d4a4ga_: