Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
Protein automated matches [190752] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187947] (9 PDB entries) |
Domain d4a4ga_: 4a4g A: [250922] automated match to d1mhna_ protein/RNA complex; complexed with da2 |
PDB Entry: 4a4g (more details)
SCOPe Domain Sequences for d4a4ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a4ga_ b.34.9.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ntaaslqqwkvgdkcsaiwsedgciypatiasidfkretcvvvytgygnreeqnlsdlls pice
Timeline for d4a4ga_: