Lineage for d4a3yb_ (4a3y B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084128Species Rauvolfia serpentina [TaxId:4060] [189830] (12 PDB entries)
  8. 2084132Domain d4a3yb_: 4a3y B: [250918]
    automated match to d3u57a_
    complexed with gol, so4

Details for d4a3yb_

PDB Entry: 4a3y (more details), 2.15 Å

PDB Description: Crystal structure of Raucaffricine glucosidase from ajmaline biosynthesis pathway
PDB Compounds: (B:) Raucaffricine-O-beta-D-glucosidase

SCOPe Domain Sequences for d4a3yb_:

Sequence, based on SEQRES records: (download)

>d4a3yb_ c.1.8.0 (B:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfsv
hgyatglyapgrgrtspehvnhptvqhrcstvapqcicstgnpgtepywvthhlllahaa
avelyknkfqrgqegqigishatqwmepwdensasdveaaaraldfmlgwfmepitsgdy
pksmkkfvgsrlpkfspeqskmlkgsydfvglnyytasyvtnastnssgsnnfsyntdih
vtyetdrngvpigpqsgsdwlliypegirkilvytkktynvpliyvtengvddvkntnlt
lsearkdsmrlkylqdhifnvrqamndgvnvkgyfawslldnfewgegygvrfgiihidy
ndnfarypkdsavwlmnsfhk

Sequence, based on observed residues (ATOM records): (download)

>d4a3yb_ c.1.8.0 (B:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
datrisrsdfpadfimgtgssayqieggardggrgpsiwdtfthrrpdmirggtngdvav
dsyhlykedvnilknlgldayrfsiswsrvlpggrlsggvnkeginyynnlidgllangi
kpfvtlfhwdvpqaledeyggflsprivddfceyaelcfwefgdrvkhwmtlnepwtfsv
hgyatglyapgrgrtgnpgtepywvthhlllahaaavelyknkfqrgqegqigishatqw
mepwdensasdveaaaraldfmlgwfmepitsgdypksmkkfvgsrlpkfspeqskmlkg
sydfvglnyytasyvtnanfsyntdihvtyetdrngvpigpqsgsdwlliypegirkilv
ytkktynvpliyvtengvddvkntnltlsearkdsmrlkylqdhifnvrqamndgvnvkg
yfawslldnfewgegygvrfgiihidyndnfarypkdsavwlmnsfhk

SCOPe Domain Coordinates for d4a3yb_:

Click to download the PDB-style file with coordinates for d4a3yb_.
(The format of our PDB-style files is described here.)

Timeline for d4a3yb_: