Lineage for d4a2va_ (4a2v A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073241Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2073314Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2073356Family b.88.2.0: automated matches [254319] (1 protein)
    not a true family
  6. 2073357Protein automated matches [254732] (1 species)
    not a true protein
  7. 2073358Species Duck (Anas platyrhynchos) [TaxId:8839] [256172] (1 PDB entry)
  8. 2073359Domain d4a2va_: 4a2v A: [250916]
    automated match to d2qfba_
    complexed with gol, zn

Details for d4a2va_

PDB Entry: 4a2v (more details), 1.44 Å

PDB Description: structure of duck rig-i c-terminal domain (ctd)
PDB Compounds: (A:) retinoic acid inducible protein I

SCOPe Domain Sequences for d4a2va_:

Sequence, based on SEQRES records: (download)

>d4a2va_ b.88.2.0 (A:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
qknllcgkckayacstddiriikdshhivlgeafkeryttkphkkpmqfdgfekkskmyc
rnnncqhdwgitvkyltfdnlpvikiksfvmestatgtqmdfqkwksinsslknfdveem
snlyppf

Sequence, based on observed residues (ATOM records): (download)

>d4a2va_ b.88.2.0 (A:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
qknllcgkckayacstddiriikdshhivlgeafkeryttkphkkpmqfdgfekkskmyc
rnnncqhdwgitvkyltfdnlpvikiksfvmesqmdfqkwksinsslknfdveemsnlyp
pf

SCOPe Domain Coordinates for d4a2va_:

Click to download the PDB-style file with coordinates for d4a2va_.
(The format of our PDB-style files is described here.)

Timeline for d4a2va_: