Lineage for d4a2uh2 (4a2u H:145-224)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694919Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)
  8. 2694929Domain d4a2uh2: 4a2u H:145-224 [250915]
    Other proteins in same PDB: d4a2ua1, d4a2ub1, d4a2uc1, d4a2ud1, d4a2ue1, d4a2uf1, d4a2uf3, d4a2ug1, d4a2uh1, d4a2uh3
    automated match to d3d0sa2
    complexed with cmp

Details for d4a2uh2

PDB Entry: 4a2u (more details), 2.63 Å

PDB Description: CRP(CAP) from Myco. Tuberculosis, with cAMP
PDB Compounds: (H:) probable transcriptional regulatory protein (probably crp/ fnr-family)

SCOPe Domain Sequences for d4a2uh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2uh2 a.4.5.0 (H:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarrar

SCOPe Domain Coordinates for d4a2uh2:

Click to download the PDB-style file with coordinates for d4a2uh2.
(The format of our PDB-style files is described here.)

Timeline for d4a2uh2: