SCOPe 2.04: Domain d4a2ua1: 4a2u A:1-144

Lineage for d4a2ua1 (4a2u A:1-144)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (10 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries)

8. Domain d4a2ua1: 4a2u A:1-144 [250900]
   Other proteins in same PDB: d4a2ua2, d4a2ub2, d4a2uc2, d4a2ud2, d4a2ue2, d4a2uf2, d4a2ug2, d4a2uh2
   automated match to d3d0sa1
   complexed with cmp

Details for d4a2ua1

PDB Entry: 4a2u, 2.63 Å

PDB Description: CRP(CAP) from Myco. Tuberculosis, with cAMP

PDB Compounds: (A:) probable transcriptional regulatory protein (probably crp/ fnr-family)

SCOPe Domain Sequences for d4a2ua1:

Sequence; same for both SEQRES and ATOM records:

>d4a2ua1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
eqllrvlarrlrrtnnnladlift

Timeline for d4a2ua1:

• d4a2ua1 is new in SCOPe 2.04-stable
  
• d4a2ua1 appears in SCOPe 2.05
  
• d4a2ua1 appears in the current release, SCOPe 2.08