![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (20 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries) |
![]() | Domain d4a2ua1: 4a2u A:1-144 [250900] Other proteins in same PDB: d4a2ua2, d4a2ub2, d4a2uc2, d4a2ud2, d4a2ue2, d4a2uf2, d4a2uf3, d4a2ug2, d4a2uh2, d4a2uh3 automated match to d3d0sa1 complexed with cmp |
PDB Entry: 4a2u (more details), 2.63 Å
SCOPe Domain Sequences for d4a2ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a2ua1 b.82.3.0 (A:1-144) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis eqllrvlarrlrrtnnnladlift
Timeline for d4a2ua1: