SCOPe 2.07: Domain d4a2ga3: 4a2g A:321-517

Lineage for d4a2ga3 (4a2g A:321-517)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (29 species)
   not a true protein

7. Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries)

8. Domain d4a2ga3: 4a2g A:321-517 [250896]
   automated match to d1gyca3
   complexed with cu

Details for d4a2ga3

PDB Entry: 4a2g, 1.8 Å

PDB Description: coriolopsis gallica laccase collected at 8.98 kev

PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d4a2ga3:

Sequence; same for both SEQRES and ATOM records:

>d4a2ga3 b.6.1.0 (A:321-517) automated matches {Coriolopsis gallica [TaxId: 76126]}
vesalttlkgtaapgsptpggvdlalnmafgfaggnftingasftpptvpvllqilsgaq
saadllpagsvyslpanadieislpataaapgfphpfhlhghvfavvrsagsstynyanp
vyrdvvstgapgdnvtirfrtdnpgpwflhchidfhleagfavvmaedipdvaatnpvpq
awsdlcptydalspddq

Timeline for d4a2ga3:

• d4a2ga3 first appeared in SCOPe 2.04
  
• d4a2ga3 appears in SCOPe 2.06
  
• d4a2ga3 appears in the current release, SCOPe 2.08