Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (20 species) not a true protein |
Species Coriolopsis gallica [TaxId:76126] [256171] (5 PDB entries) |
Domain d4a2fa1: 4a2f A:22-151 [250891] automated match to d1gyca1 complexed with cu |
PDB Entry: 4a2f (more details), 1.9 Å
SCOPe Domain Sequences for d4a2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a2fa1 b.6.1.0 (A:22-151) automated matches {Coriolopsis gallica [TaxId: 76126]} aigpvadltisngavspdgfsrqailvndvfpsplitgnkgdrfqlnvidnmtnhtmlks tsihwhgffqhgtnwadgpafvnqcpistghaflydfqvpdqagtfwyhshlstqycdgl rgpivvydpn
Timeline for d4a2fa1: