Lineage for d4a2ea3 (4a2e A:321-517)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772380Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries)
  8. 2772389Domain d4a2ea3: 4a2e A:321-517 [250890]
    automated match to d1gyca3
    complexed with cu

Details for d4a2ea3

PDB Entry: 4a2e (more details), 1.8 Å

PDB Description: crystal structure of a coriolopsis gallica laccase at 1.7 a resolution ph 5.5
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d4a2ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a2ea3 b.6.1.0 (A:321-517) automated matches {Coriolopsis gallica [TaxId: 76126]}
vesalttlkgtaapgsptpggvdlalnmafgfaggnftingasftpptvpvllqilsgaq
saadllpagsvyslpanadieislpataaapgfphpfhlhghvfavvrsagsstynyanp
vyrdvvstgapgdnvtirfrtdnpgpwflhchidfhleagfavvmaedipdvaatnpvpq
awsdlcptydalspddq

SCOPe Domain Coordinates for d4a2ea3:

Click to download the PDB-style file with coordinates for d4a2ea3.
(The format of our PDB-style files is described here.)

Timeline for d4a2ea3: