| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries) |
| Domain d4a2ea2: 4a2e A:152-320 [250889] automated match to d1gyca2 complexed with cu |
PDB Entry: 4a2e (more details), 1.8 Å
SCOPe Domain Sequences for d4a2ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a2ea2 b.6.1.0 (A:152-320) automated matches {Coriolopsis gallica [TaxId: 76126]}
dphaslydvdddstvitladwyhlaakvgapvptadatlinglgrsaatlaadlavitvt
kgkryrfrlvslscdpnytfsidghsltvieadsvnlkphtvdslqifaaqrysfvlnad
qdvdnywiralpnsgtqnfaggtnsailrydgaapvepttsqtpstnpl
Timeline for d4a2ea2: