SCOPe 2.07: Domain d4a24a1: 4a24 A:501-544

Lineage for d4a24a1 (4a24 A:501-544)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888)

4. Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families)

5. Family g.85.1.1: MYND zinc finger [144233] (4 proteins)
   Pfam PF01753

6. Protein Deformed epidermal autoregulatory factor 1, DEAF-1 [144234] (1 species)
   Zinc finger MYND domain-containing protein 5

7. Species Human (Homo sapiens) [TaxId:9606] [144235] (2 PDB entries)
   Uniprot O75398 503-544

8. Domain d4a24a1: 4a24 A:501-544 [250884]
   Other proteins in same PDB: d4a24a2
   automated match to d2dj8a1
   complexed with zn

Details for d4a24a1

PDB Entry: 4a24

PDB Description: structural and functional analysis of the deaf-1 and bs69 mynd domains

PDB Compounds: (A:) Deformed epidermal autoregulatory factor 1 homolog

SCOPe Domain Sequences for d4a24a1:

Sequence; same for both SEQRES and ATOM records:

>d4a24a1 g.85.1.1 (A:501-544) Deformed epidermal autoregulatory factor 1, DEAF-1 {Human (Homo sapiens) [TaxId: 9606]}
eqscvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa

Timeline for d4a24a1:

• d4a24a1 first appeared in SCOPe 2.04, called d4a24a_
  
• d4a24a1 appears in SCOPe 2.06
  
• d4a24a1 appears in the current release, SCOPe 2.08