Lineage for d4a24a1 (4a24 A:501-544)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038778Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888)
  4. 3038779Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) (S)
  5. 3038780Family g.85.1.1: MYND zinc finger [144233] (4 proteins)
    Pfam PF01753
  6. 3038781Protein Deformed epidermal autoregulatory factor 1, DEAF-1 [144234] (1 species)
    Zinc finger MYND domain-containing protein 5
  7. 3038782Species Human (Homo sapiens) [TaxId:9606] [144235] (2 PDB entries)
    Uniprot O75398 503-544
  8. 3038783Domain d4a24a1: 4a24 A:501-544 [250884]
    Other proteins in same PDB: d4a24a2
    automated match to d2dj8a1
    complexed with zn

Details for d4a24a1

PDB Entry: 4a24 (more details)

PDB Description: structural and functional analysis of the deaf-1 and bs69 mynd domains
PDB Compounds: (A:) Deformed epidermal autoregulatory factor 1 homolog

SCOPe Domain Sequences for d4a24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a24a1 g.85.1.1 (A:501-544) Deformed epidermal autoregulatory factor 1, DEAF-1 {Human (Homo sapiens) [TaxId: 9606]}
eqscvncgreamsectgchkvnycstfcqrkdwkdhqhicgqsa

SCOPe Domain Coordinates for d4a24a1:

Click to download the PDB-style file with coordinates for d4a24a1.
(The format of our PDB-style files is described here.)

Timeline for d4a24a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a24a2