Lineage for d3zw3a1 (3zw3 A:144-321)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933354Domain d3zw3a1: 3zw3 A:144-321 [250879]
    Other proteins in same PDB: d3zw3a2, d3zw3a3
    automated match to d1e7ua3
    complexed with zw3

Details for d3zw3a1

PDB Entry: 3zw3 (more details), 2.8 Å

PDB Description: fragment based discovery of a novel and selective pi3 kinase inhibitor
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zw3a1:

Sequence, based on SEQRES records: (download)

>d3zw3a1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d3zw3a1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d3zw3a1:

Click to download the PDB-style file with coordinates for d3zw3a1.
(The format of our PDB-style files is described here.)

Timeline for d3zw3a1: