SCOPe 2.07: Domain d3zw3a1: 3zw3 A:144-321

Lineage for d3zw3a1 (3zw3 A:144-321)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (76 PDB entries)

8. Domain d3zw3a1: 3zw3 A:144-321 [250879]
   Other proteins in same PDB: d3zw3a2, d3zw3a3
   automated match to d1e7ua3
   complexed with zw3

Details for d3zw3a1

PDB Entry: 3zw3, 2.8 Å

PDB Description: fragment based discovery of a novel and selective pi3 kinase inhibitor

PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zw3a1:

Sequence, based on SEQRES records:

>d3zw3a1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records):

>d3zw3a1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Timeline for d3zw3a1:

• d3zw3a1 first appeared in SCOPe 2.04
  
• d3zw3a1 appears in SCOPe 2.06