Lineage for d3zvva4 (3zvv A:726-1092)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932655Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)
  8. 1933118Domain d3zvva4: 3zvv A:726-1092 [250878]
    Other proteins in same PDB: d3zvva1, d3zvva2, d3zvva3
    automated match to d1e7ua4
    complexed with xaz

Details for d3zvva4

PDB Entry: 3zvv (more details), 2.5 Å

PDB Description: fragment bound to pi3kinase gamma
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zvva4:

Sequence, based on SEQRES records: (download)

>d3zvva4 d.144.1.0 (A:726-1092) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlvl

Sequence, based on observed residues (ATOM records): (download)

>d3zvva4 d.144.1.0 (A:726-1092) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslisqlkqklenlqnsqlpesfrvpydpglkagal
aiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwe
tesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkeksp
teekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghervpfvltp
dflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqltskedie
yirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl

SCOPe Domain Coordinates for d3zvva4:

Click to download the PDB-style file with coordinates for d3zvva4.
(The format of our PDB-style files is described here.)

Timeline for d3zvva4: