Lineage for d3zvva3 (3zvv A:525-725)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726158Domain d3zvva3: 3zvv A:525-725 [250877]
    Other proteins in same PDB: d3zvva1, d3zvva2, d3zvva4
    automated match to d1e7ua1
    complexed with xaz

Details for d3zvva3

PDB Entry: 3zvv (more details), 2.5 Å

PDB Description: fragment bound to pi3kinase gamma
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zvva3:

Sequence, based on SEQRES records: (download)

>d3zvva3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3zvva3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d3zvva3:

Click to download the PDB-style file with coordinates for d3zvva3.
(The format of our PDB-style files is described here.)

Timeline for d3zvva3: