Lineage for d3zvva2 (3zvv A:357-522)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773076Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)
  8. 2773114Domain d3zvva2: 3zvv A:357-522 [250876]
    Other proteins in same PDB: d3zvva1, d3zvva3, d3zvva4
    automated match to d1e8wa2
    complexed with xaz

Details for d3zvva2

PDB Entry: 3zvv (more details), 2.5 Å

PDB Description: fragment bound to pi3kinase gamma
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3zvva2:

Sequence, based on SEQRES records: (download)

>d3zvva2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d3zvva2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn
pdkensmsisilldn

SCOPe Domain Coordinates for d3zvva2:

Click to download the PDB-style file with coordinates for d3zvva2.
(The format of our PDB-style files is described here.)

Timeline for d3zvva2: