SCOPe 2.06: Domain d3zvjp1: 3zvj P:1-166

Lineage for d3zvjp1 (3zvj P:1-166)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)

8. Domain d3zvjp1: 3zvj P:1-166 [250866]
   Other proteins in same PDB: d3zvjb2, d3zvjc2, d3zvjf2, d3zvjk2, d3zvjl2, d3zvjm2, d3zvjo2, d3zvjp2, d3zvjr2, d3zvjs2, d3zvjt2
   automated match to d2i81b_

Details for d3zvjp1

PDB Entry: 3zvj, 3 Å

PDB Description: Crystal structure of high molecular weight (HMW) form of Peroxiredoxin I from Schistosoma mansoni

PDB Compounds: (P:) thioredoxin peroxidase

SCOPe Domain Sequences for d3zvjp1:

Sequence; same for both SEQRES and ATOM records:

>d3zvjp1 c.47.1.0 (P:1-166) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mvllpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvcpteiiafsdqve
efnsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeedg
nafrglfiidpngilrqitindkpvgrsvdetlrlldafqfvekhg

Timeline for d3zvjp1:

• d3zvjp1 first appeared in SCOPe 2.04, called d3zvjp_
  
• d3zvjp1 was called d3zvjp_ in SCOPe 2.05
  
• d3zvjp1 appears in SCOPe 2.07
  
• d3zvjp1 appears in the current release, SCOPe 2.08