Lineage for d3zvjj_ (3zvj J:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487138Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)
  8. 2487175Domain d3zvjj_: 3zvj J: [250860]
    Other proteins in same PDB: d3zvjb2, d3zvjc2, d3zvjf2, d3zvjk2, d3zvjl2, d3zvjm2, d3zvjo2, d3zvjp2, d3zvjr2, d3zvjs2, d3zvjt2
    automated match to d2i81b_

Details for d3zvjj_

PDB Entry: 3zvj (more details), 3 Å

PDB Description: Crystal structure of high molecular weight (HMW) form of Peroxiredoxin I from Schistosoma mansoni
PDB Compounds: (J:) thioredoxin peroxidase

SCOPe Domain Sequences for d3zvjj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvjj_ c.47.1.0 (J:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mvllpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvcpteiiafsdqve
efnsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeedg
nafrglfiidpngilrqitindkpvgrsvdetlrlldafqfvekhgevcpv

SCOPe Domain Coordinates for d3zvjj_:

Click to download the PDB-style file with coordinates for d3zvjj_.
(The format of our PDB-style files is described here.)

Timeline for d3zvjj_: