| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (188 species) not a true protein |
| Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries) |
| Domain d3zvjj_: 3zvj J: [250860] Other proteins in same PDB: d3zvjb2, d3zvjc2, d3zvjf2, d3zvjk2, d3zvjl2, d3zvjm2, d3zvjo2, d3zvjp2, d3zvjr2, d3zvjs2, d3zvjt2 automated match to d2i81b_ |
PDB Entry: 3zvj (more details), 3 Å
SCOPe Domain Sequences for d3zvjj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvjj_ c.47.1.0 (J:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mvllpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvcpteiiafsdqve
efnsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeedg
nafrglfiidpngilrqitindkpvgrsvdetlrlldafqfvekhgevcpv
Timeline for d3zvjj_:
View in 3DDomains from other chains: (mouse over for more information) d3zvja_, d3zvjb1, d3zvjb2, d3zvjc1, d3zvjc2, d3zvjd_, d3zvje_, d3zvjf1, d3zvjf2, d3zvjg_, d3zvjh_, d3zvji_, d3zvjk1, d3zvjk2, d3zvjl1, d3zvjl2, d3zvjm1, d3zvjm2, d3zvjn_, d3zvjo1, d3zvjo2, d3zvjp1, d3zvjp2, d3zvjq_, d3zvjr1, d3zvjr2, d3zvjs1, d3zvjs2, d3zvjt1, d3zvjt2 |